PCDHA7 monoclonal antibody (M08), clone 1C7 View larger

PCDHA7 monoclonal antibody (M08), clone 1C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHA7 monoclonal antibody (M08), clone 1C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PCDHA7 monoclonal antibody (M08), clone 1C7

Brand: Abnova
Reference: H00056141-M08
Product name: PCDHA7 monoclonal antibody (M08), clone 1C7
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHA7.
Clone: 1C7
Isotype: IgG2a Kappa
Gene id: 56141
Gene name: PCDHA7
Gene alias: CNR4|CNRN4|CNRS4|CRNR4|PCDH-ALPHA7
Gene description: protocadherin alpha 7
Genbank accession: NM_018910
Immunogen: PCDHA7 (NP_061733, 143 a.a. ~ 241 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPV
Protein accession: NP_061733
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056141-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056141-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PCDHA7 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCDHA7 monoclonal antibody (M08), clone 1C7 now

Add to cart