Brand: | Abnova |
Reference: | H00056141-M08 |
Product name: | PCDHA7 monoclonal antibody (M08), clone 1C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDHA7. |
Clone: | 1C7 |
Isotype: | IgG2a Kappa |
Gene id: | 56141 |
Gene name: | PCDHA7 |
Gene alias: | CNR4|CNRN4|CNRS4|CRNR4|PCDH-ALPHA7 |
Gene description: | protocadherin alpha 7 |
Genbank accession: | NM_018910 |
Immunogen: | PCDHA7 (NP_061733, 143 a.a. ~ 241 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPV |
Protein accession: | NP_061733 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PCDHA7 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |