PCDHB3 monoclonal antibody (M01), clone 4F6 View larger

PCDHB3 monoclonal antibody (M01), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHB3 monoclonal antibody (M01), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCDHB3 monoclonal antibody (M01), clone 4F6

Brand: Abnova
Reference: H00056132-M01
Product name: PCDHB3 monoclonal antibody (M01), clone 4F6
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHB3.
Clone: 4F6
Isotype: IgG2a Kappa
Gene id: 56132
Gene name: PCDHB3
Gene alias: PCDH-BETA3
Gene description: protocadherin beta 3
Genbank accession: NM_018937
Immunogen: PCDHB3 (NP_061760, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENSGETVLAVFSVSDLDSGDNGRV
Protein accession: NP_061760
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056132-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056132-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PCDHB3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHB3 monoclonal antibody (M01), clone 4F6 now

Add to cart