PCDHB10 monoclonal antibody (M07), clone 4C4 View larger

PCDHB10 monoclonal antibody (M07), clone 4C4

H00056126-M07_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHB10 monoclonal antibody (M07), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about PCDHB10 monoclonal antibody (M07), clone 4C4

Brand: Abnova
Reference: H00056126-M07
Product name: PCDHB10 monoclonal antibody (M07), clone 4C4
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHB10.
Clone: 4C4
Isotype: IgG2a Kappa
Gene id: 56126
Gene name: PCDHB10
Gene alias: PCDH-BETA10|PCHB10
Gene description: protocadherin beta 10
Genbank accession: NM_018930
Immunogen: PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD
Protein accession: NP_061753
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056126-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00056126-M07-1-8-1.jpg
Application image note: PCDHB10 monoclonal antibody (M07), clone 4C4 Western Blot analysis of PCDHB10 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Gene expression profiling-based identification of cell-surface targets for developing multimeric ligands in pancreatic cancer.Balagurunathan Y, Morse DL, Hostetter G, Shanmugam V, Stafford P, Shack S, Pearson J, Trissal M, Demeure MJ, Von Hoff DD, Hruby VJ, Gillies RJ, Han H.
Mol Cancer Ther. 2008 Sep;7(9):3071-80. Epub 2008 Sep 2.

Reviews

Buy PCDHB10 monoclonal antibody (M07), clone 4C4 now

Add to cart