Brand: | Abnova |
Reference: | H00056126-A01 |
Product name: | PCDHB10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PCDHB10. |
Gene id: | 56126 |
Gene name: | PCDHB10 |
Gene alias: | PCDH-BETA10|PCHB10 |
Gene description: | protocadherin beta 10 |
Genbank accession: | NM_018930 |
Immunogen: | PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD |
Protein accession: | NP_061753 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |