PCDHB15 monoclonal antibody (M02), clone 2E10 View larger

PCDHB15 monoclonal antibody (M02), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHB15 monoclonal antibody (M02), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PCDHB15 monoclonal antibody (M02), clone 2E10

Brand: Abnova
Reference: H00056121-M02
Product name: PCDHB15 monoclonal antibody (M02), clone 2E10
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHB15.
Clone: 2E10
Isotype: IgG2a Kappa
Gene id: 56121
Gene name: PCDHB15
Gene alias: PCDH-BETA15
Gene description: protocadherin beta 15
Genbank accession: NM_018935
Immunogen: PCDHB15 (NP_061758, 207 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELRLTLTAVDGGSPPRSGTVQILILVLDANDNAPEFVQALYEVQVPENSPVGSLVVKVSARDLDTGTNGEISYSLYYSSQEIDKPFELSSLSGEIRLIKK
Protein accession: NP_061758
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056121-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHB15 monoclonal antibody (M02), clone 2E10 now

Add to cart