Brand: | Abnova |
Reference: | H00056114-M02 |
Product name: | PCDHGA1 monoclonal antibody (M02), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDHGA1. |
Clone: | 1D2 |
Isotype: | IgG2a Kappa |
Gene id: | 56114 |
Gene name: | PCDHGA1 |
Gene alias: | MGC138287|MGC138289|PCDH-GAMMA-A1 |
Gene description: | protocadherin gamma subfamily A, 1 |
Genbank accession: | NM_018912 |
Immunogen: | PCDHGA1 (NP_061735, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDV |
Protein accession: | NP_061735 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |