PCDHGA2 monoclonal antibody (M01A), clone 2A7 View larger

PCDHGA2 monoclonal antibody (M01A), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHGA2 monoclonal antibody (M01A), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about PCDHGA2 monoclonal antibody (M01A), clone 2A7

Brand: Abnova
Reference: H00056113-M01A
Product name: PCDHGA2 monoclonal antibody (M01A), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHGA2.
Clone: 2A7
Isotype: IgG2a Kappa
Gene id: 56113
Gene name: PCDHGA2
Gene alias: PCDH-GAMMA-A2
Gene description: protocadherin gamma subfamily A, 2
Genbank accession: NM_018915
Immunogen: PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA
Protein accession: NP_061738
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056113-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00056113-M01A-1-27-1.jpg
Application image note: PCDHGA2 monoclonal antibody (M01A), clone 2A7. Western Blot analysis of PCDHGA2 expression in Raw 264.7.
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCDHGA2 monoclonal antibody (M01A), clone 2A7 now

Add to cart