PCDHGA10 monoclonal antibody (M04), clone 3A7 View larger

PCDHGA10 monoclonal antibody (M04), clone 3A7

H00056106-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHGA10 monoclonal antibody (M04), clone 3A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCDHGA10 monoclonal antibody (M04), clone 3A7

Brand: Abnova
Reference: H00056106-M04
Product name: PCDHGA10 monoclonal antibody (M04), clone 3A7
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHGA10.
Clone: 3A7
Isotype: IgG2a Kappa
Gene id: 56106
Gene name: PCDHGA10
Gene alias: PCDH-GAMMA-A10
Gene description: protocadherin gamma subfamily A, 10
Genbank accession: NM_018913
Immunogen: PCDHGA10 (NP_061736.1, 219 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKYTGEIKISENLDYEET
Protein accession: NP_061736.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056106-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056106-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PCDHGA10 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHGA10 monoclonal antibody (M04), clone 3A7 now

Add to cart