Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PCDHGB1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about PCDHGB1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00056104-A01 |
| Product name: | PCDHGB1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCDHGB1. |
| Gene id: | 56104 |
| Gene name: | PCDHGB1 |
| Gene alias: | MGC119466|MGC119467|MGC119469|PCDH-GAMMA-B1 |
| Gene description: | protocadherin gamma subfamily B, 1 |
| Genbank accession: | NM_018922 |
| Immunogen: | PCDHGB1 (NP_061745, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FNLNPNTGDITTNGTLDFEETSRYVLSVEAKDGGVHTAHCNVQIEIVDENDNAPEVTFMSFSNQIPEDSDLGTVIALIKVRDKDSGQNGMVTCYTQEEVP |
| Protein accession: | NP_061745 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | PCDHGB1 polyclonal antibody (A01), Lot # 051129JCO1 Western Blot analysis of PCDHGB1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |