Brand: | Abnova |
Reference: | H00056034-A01 |
Product name: | PDGFC polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDGFC. |
Gene id: | 56034 |
Gene name: | PDGFC |
Gene alias: | FALLOTEIN|SCDGF |
Gene description: | platelet derived growth factor C |
Genbank accession: | NM_016205 |
Immunogen: | PDGFC (NP_057289, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG |
Protein accession: | NP_057289 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PDGFC polyclonal antibody (A01), Lot # 050926JC01 Western Blot analysis of PDGFC expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |