BARX1 monoclonal antibody (M06), clone 1B3 View larger

BARX1 monoclonal antibody (M06), clone 1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BARX1 monoclonal antibody (M06), clone 1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BARX1 monoclonal antibody (M06), clone 1B3

Brand: Abnova
Reference: H00056033-M06
Product name: BARX1 monoclonal antibody (M06), clone 1B3
Product description: Mouse monoclonal antibody raised against a full length recombinant BARX1.
Clone: 1B3
Isotype: IgG1 lambda
Gene id: 56033
Gene name: BARX1
Gene alias: -
Gene description: BARX homeobox 1
Genbank accession: BC009458
Immunogen: BARX1 (AAH09458, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED
Protein accession: AAH09458
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056033-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056033-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged BARX1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BARX1 monoclonal antibody (M06), clone 1B3 now

Add to cart