Brand: | Abnova |
Reference: | H00055997-M09 |
Product name: | CFC1 monoclonal antibody (M09), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CFC1. |
Clone: | 2G4 |
Isotype: | IgG2a Kappa |
Gene id: | 55997 |
Gene name: | CFC1 |
Gene alias: | CRYPTIC|FLJ77897|HTX2|MGC133213 |
Gene description: | cripto, FRL-1, cryptic family 1 |
Genbank accession: | NM_032545 |
Immunogen: | CFC1 (NP_115934.1, 27 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRN |
Protein accession: | NP_115934.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CFC1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |