CFC1 monoclonal antibody (M09), clone 2G4 View larger

CFC1 monoclonal antibody (M09), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CFC1 monoclonal antibody (M09), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about CFC1 monoclonal antibody (M09), clone 2G4

Brand: Abnova
Reference: H00055997-M09
Product name: CFC1 monoclonal antibody (M09), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant CFC1.
Clone: 2G4
Isotype: IgG2a Kappa
Gene id: 55997
Gene name: CFC1
Gene alias: CRYPTIC|FLJ77897|HTX2|MGC133213
Gene description: cripto, FRL-1, cryptic family 1
Genbank accession: NM_032545
Immunogen: CFC1 (NP_115934.1, 27 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRN
Protein accession: NP_115934.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055997-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055997-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CFC1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy CFC1 monoclonal antibody (M09), clone 2G4 now

Add to cart