Brand: | Abnova |
Reference: | H00055973-M07 |
Product name: | BCAP29 monoclonal antibody (M07), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BCAP29. |
Clone: | 4B10 |
Isotype: | IgG2a Kappa |
Gene id: | 55973 |
Gene name: | BCAP29 |
Gene alias: | BAP29|DKFZp686M2086 |
Gene description: | B-cell receptor-associated protein 29 |
Genbank accession: | BC008478 |
Immunogen: | BCAP29 (AAH08478, 125 a.a. ~ 241 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL |
Protein accession: | AAH08478 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.5 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to BCAP29 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |