Brand: | Abnova |
Reference: | H00055973-D01 |
Product name: | BCAP29 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human BCAP29 protein. |
Gene id: | 55973 |
Gene name: | BCAP29 |
Gene alias: | BAP29|DKFZp686M2086 |
Gene description: | B-cell receptor-associated protein 29 |
Genbank accession: | NM_018844 |
Immunogen: | BCAP29 (NP_061332.2, 1 a.a. ~ 241 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL |
Protein accession: | NP_061332.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in mouse liver. |
Applications: | WB-Ce,WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |