SEPT3 monoclonal antibody (M05), clone 1F6 View larger

SEPT3 monoclonal antibody (M05), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT3 monoclonal antibody (M05), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SEPT3 monoclonal antibody (M05), clone 1F6

Brand: Abnova
Reference: H00055964-M05
Product name: SEPT3 monoclonal antibody (M05), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant SEPT3.
Clone: 1F6
Isotype: IgG1 Kappa
Gene id: 55964
Gene name: SEPT3
Gene alias: MGC133218|SEP3|bK250D10.3
Gene description: septin 3
Genbank accession: NM_145733
Immunogen: SEPT3 (NP_663786, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Protein accession: NP_663786
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055964-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00055964-M05-1-6-1.jpg
Application image note: SEPT3 monoclonal antibody (M05), clone 1F6. Western Blot analysis of SEPT3 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SEPT3 monoclonal antibody (M05), clone 1F6 now

Add to cart