Brand: | Abnova |
Reference: | H00055937-P01 |
Product name: | APOM (Human) Recombinant Protein (P01) |
Product description: | Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 55937 |
Gene name: | APOM |
Gene alias: | G3a|HSPC336|MGC22400|NG20 |
Gene description: | apolipoprotein M |
Genbank accession: | BC020683 |
Immunogen sequence/protein sequence: | CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN |
Protein accession: | AAH20683 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Evaluation of Apolipoprotein M Serum Concentration as a Biomarker of HNF-1alpha MODY.Skupien J, Kepka G, Gorczynska-Kosiorz S, Gebska A, Klupa T, Wanic K, Nowak N, Borowiec M, Sieradzki J, Malecki MT. Rev Diabet Stud. 2007 Winter;4(4):231-5. Epub 2008 Feb 10. |