APOM (Human) Recombinant Protein (P01) View larger

APOM (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOM (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about APOM (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00055937-P01
Product name: APOM (Human) Recombinant Protein (P01)
Product description: Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 55937
Gene name: APOM
Gene alias: G3a|HSPC336|MGC22400|NG20
Gene description: apolipoprotein M
Genbank accession: BC020683
Immunogen sequence/protein sequence: CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Protein accession: AAH20683
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00055937-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Evaluation of Apolipoprotein M Serum Concentration as a Biomarker of HNF-1alpha MODY.Skupien J, Kepka G, Gorczynska-Kosiorz S, Gebska A, Klupa T, Wanic K, Nowak N, Borowiec M, Sieradzki J, Malecki MT.
Rev Diabet Stud. 2007 Winter;4(4):231-5. Epub 2008 Feb 10.

Reviews

Buy APOM (Human) Recombinant Protein (P01) now

Add to cart