APOM monoclonal antibody (M01), clone 1F10 View larger

APOM monoclonal antibody (M01), clone 1F10

H00055937-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOM monoclonal antibody (M01), clone 1F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about APOM monoclonal antibody (M01), clone 1F10

Brand: Abnova
Reference: H00055937-M01
Product name: APOM monoclonal antibody (M01), clone 1F10
Product description: Mouse monoclonal antibody raised against a full length recombinant APOM.
Clone: 1F10
Isotype: IgG1
Gene id: 55937
Gene name: APOM
Gene alias: G3a|HSPC336|MGC22400|NG20
Gene description: apolipoprotein M
Genbank accession: BC020683
Immunogen: APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Protein accession: AAH20683
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055937-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055937-M01-42-R01V-1.jpg
Application image note: Western blot analysis of APOM over-expressed 293 cell line, cotransfected with APOM Validated Chimera RNAi ( Cat # H00055937-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with APOM monoclonal antibody (M01), clone 1F10 (Cat # H00055937-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Liver X receptor agonist downregulates hepatic apoM expression in vivo and in vitro.Zhang X, Zhu Z, Luo G, Zheng L, Nilsson-Ehle P, Xu N.
Biochem Biophys Res Commun. 2008 Jun 20;371(1):114-7. Epub 2008 Apr 14.

Reviews

Buy APOM monoclonal antibody (M01), clone 1F10 now

Add to cart