Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DMAP1 monoclonal antibody (M02), clone 1A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
More info about DMAP1 monoclonal antibody (M02), clone 1A5
| Brand: | Abnova |
| Reference: | H00055929-M02 |
| Product name: | DMAP1 monoclonal antibody (M02), clone 1A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DMAP1. |
| Clone: | 1A5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55929 |
| Gene name: | DMAP1 |
| Gene alias: | DKFZp686L09142|DNMAP1|DNMTAP1|EAF2|FLJ11543|KIAA1425|SWC4 |
| Gene description: | DNA methyltransferase 1 associated protein 1 |
| Genbank accession: | NM_019100 |
| Immunogen: | DMAP1 (NP_061973, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF |
| Protein accession: | NP_061973 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5. Lane 1: DMAP1 transfected lysate(53 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |