Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00055929-M01 |
Product name: | DMAP1 monoclonal antibody (M01), clone 2G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DMAP1. |
Clone: | 2G12 |
Isotype: | IgG1 Kappa |
Gene id: | 55929 |
Gene name: | DMAP1 |
Gene alias: | DKFZp686L09142|DNMAP1|DNMTAP1|EAF2|FLJ11543|KIAA1425|SWC4 |
Gene description: | DNA methyltransferase 1 associated protein 1 |
Genbank accession: | NM_019100 |
Immunogen: | DMAP1 (NP_061973, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF |
Protein accession: | NP_061973 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M01), clone 2G12. Lane 1: DMAP1 transfected lysate(53 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Novel 1p tumour suppressor Dnmt1-associated protein 1 regulates MYCN/ataxia telangiectasia mutated/p53 pathway.Yamaguchi Y, Takenobu H, Ohira M, Nakazawa A, Yoshida S, Akita N, Shimozato O, Iwama A, Nakagawara A, Kamijo T Eur J Cancer. 2014 Feb 19. pii: S0959-8049(14)00096-3. doi: 10.1016/j.ejca.2014.01.023. |