Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00055915-B01P |
Product name: | LANCL2 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human LANCL2 protein. |
Gene id: | 55915 |
Gene name: | LANCL2 |
Gene alias: | GPR69B|MGC87139|TASP |
Gene description: | LanC lantibiotic synthetase component C-like 2 (bacterial) |
Genbank accession: | NM_018697.3 |
Immunogen: | LANCL2 (NP_061167.1, 1 a.a. ~ 450 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD |
Protein accession: | NP_061167.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LANCL2 expression in transfected 293T cell line (H00055915-T01) by LANCL2 MaxPab polyclonal antibody. Lane 1: LANCL2 transfected lysate(49.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |