LANCL2 MaxPab mouse polyclonal antibody (B01) View larger

LANCL2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LANCL2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about LANCL2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00055915-B01
Product name: LANCL2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LANCL2 protein.
Gene id: 55915
Gene name: LANCL2
Gene alias: GPR69B|MGC87139|TASP
Gene description: LanC lantibiotic synthetase component C-like 2 (bacterial)
Genbank accession: NM_018697.3
Immunogen: LANCL2 (NP_061167.1, 1 a.a. ~ 450 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD
Protein accession: NP_061167.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055915-B01-13-15-1.jpg
Application image note: Western Blot analysis of LANCL2 expression in transfected 293T cell line (H00055915-T01) by LANCL2 MaxPab polyclonal antibody.

Lane 1: LANCL2 transfected lysate(49.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LANCL2 MaxPab mouse polyclonal antibody (B01) now

Add to cart