H00055911-M03_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055911-M03 |
Product name: | APOB48R monoclonal antibody (M03), clone 2D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant APOB48R. |
Clone: | 2D7 |
Isotype: | IgG2a Kappa |
Gene id: | 55911 |
Gene name: | APOB48R |
Gene alias: | - |
Gene description: | apolipoprotein B48 receptor |
Genbank accession: | NM_018690 |
Immunogen: | APOB48R (NP_061160, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE |
Protein accession: | NP_061160 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to APOB48R on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Apolipoprotein E-deficient lipoproteins induce foam cell formation by downregulation of lysosomal hydrolases in macrophages.Wu D, Sharan C, Yang H, Goodwin JS, Zhou L, Grabowski GA, Du H, Guo Z. J Lipid Res. 2007 Dec;48(12):2571-8. Epub 2007 Aug 25. |