No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00055908-B01P |
Product name: | C19orf80 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human C19orf80 protein. |
Gene id: | 55908 |
Gene name: | C19orf80 |
Gene alias: | RIFL|TD26|PRO1185|PVPA599 |
Gene description: | chromosome 19 open reading frame 80 |
Genbank accession: | BC146552 |
Immunogen: | C19orf80 (AAI46553.1, 1 a.a. ~ 251 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLRPSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
Protein accession: | AAI46553.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of C19orf80 expression in transfected 293T cell line (H00055908-T01) by C19orf80 MaxPab polyclonal antibody. Lane 1: C19orf80 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |