MESP1 monoclonal antibody (M09), clone 4B4 View larger

MESP1 monoclonal antibody (M09), clone 4B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MESP1 monoclonal antibody (M09), clone 4B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MESP1 monoclonal antibody (M09), clone 4B4

Brand: Abnova
Reference: H00055897-M09
Product name: MESP1 monoclonal antibody (M09), clone 4B4
Product description: Mouse monoclonal antibody raised against a partial recombinant MESP1.
Clone: 4B4
Isotype: IgG2a Kappa
Gene id: 55897
Gene name: MESP1
Gene alias: MGC10676|bHLHc5
Gene description: mesoderm posterior 1 homolog (mouse)
Genbank accession: NM_018670
Immunogen: MESP1 (NP_061140.1, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD
Protein accession: NP_061140.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055897-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055897-M09-1-18-1.jpg
Application image note: MESP1 monoclonal antibody (M09), clone 4B4 Western Blot analysis of MESP1 expression in COLO 320 HSR ( Cat # L020V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MESP1 monoclonal antibody (M09), clone 4B4 now

Add to cart