MYNN monoclonal antibody (M02), clone 4B4 View larger

MYNN monoclonal antibody (M02), clone 4B4

H00055892-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYNN monoclonal antibody (M02), clone 4B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about MYNN monoclonal antibody (M02), clone 4B4

Brand: Abnova
Reference: H00055892-M02
Product name: MYNN monoclonal antibody (M02), clone 4B4
Product description: Mouse monoclonal antibody raised against a partial recombinant MYNN.
Clone: 4B4
Isotype: IgG2a Kappa
Gene id: 55892
Gene name: MYNN
Gene alias: OSZF|SBBIZ1|ZBTB31
Gene description: myoneurin
Genbank accession: NM_018657
Immunogen: MYNN (NP_061127, 501 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY
Protein accession: NP_061127
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055892-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055892-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MYNN on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MYNN monoclonal antibody (M02), clone 4B4 now

Add to cart