Brand: | Abnova |
Reference: | H00055885-M07 |
Product name: | LMO3 monoclonal antibody (M07), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LMO3. |
Clone: | 1A8 |
Isotype: | IgG2b Kappa |
Gene id: | 55885 |
Gene name: | LMO3 |
Gene alias: | DAT1|MGC26081|RBTN3|RBTNL2|RHOM3|Rhom-3 |
Gene description: | LIM domain only 3 (rhombotin-like 2) |
Genbank accession: | NM_018640 |
Immunogen: | LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR |
Protein accession: | NP_061110 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.16 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged LMO3 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |