LMO3 monoclonal antibody (M06), clone 4A8 View larger

LMO3 monoclonal antibody (M06), clone 4A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LMO3 monoclonal antibody (M06), clone 4A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about LMO3 monoclonal antibody (M06), clone 4A8

Brand: Abnova
Reference: H00055885-M06
Product name: LMO3 monoclonal antibody (M06), clone 4A8
Product description: Mouse monoclonal antibody raised against a partial recombinant LMO3.
Clone: 4A8
Isotype: IgG2b Kappa
Gene id: 55885
Gene name: LMO3
Gene alias: DAT1|MGC26081|RBTN3|RBTNL2|RHOM3|Rhom-3
Gene description: LIM domain only 3 (rhombotin-like 2)
Genbank accession: NM_018640
Immunogen: LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
Protein accession: NP_061110
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055885-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055885-M06-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged LMO3 is approximately 3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LMO3 monoclonal antibody (M06), clone 4A8 now

Add to cart