Brand: | Abnova |
Reference: | H00055872-M03 |
Product name: | PBK monoclonal antibody (M03), clone 2D6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PBK. |
Clone: | 2D6 |
Isotype: | IgG2a Kappa |
Gene id: | 55872 |
Gene name: | PBK |
Gene alias: | FLJ14385|Nori-3|SPK|TOPK |
Gene description: | PDZ binding kinase |
Genbank accession: | BC015191 |
Immunogen: | PBK (AAH15191, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV |
Protein accession: | AAH15191 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | PBK monoclonal antibody (M03), clone 2D6 Western Blot analysis of PBK expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |