PBK purified MaxPab rabbit polyclonal antibody (D01P) View larger

PBK purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PBK purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about PBK purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00055872-D01P
Product name: PBK purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PBK protein.
Gene id: 55872
Gene name: PBK
Gene alias: FLJ14385|Nori-3|SPK|TOPK
Gene description: PDZ binding kinase
Genbank accession: NM_018492.2
Immunogen: PBK (NP_060962.2, 1 a.a. ~ 322 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Protein accession: NP_060962.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00055872-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PBK expression in transfected 293T cell line (H00055872-T02) by PBK MaxPab polyclonal antibody.

Lane 1: PBK transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PBK purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart