Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSENEN polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PSENEN polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00055851-A01 |
| Product name: | PSENEN polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant PSENEN. |
| Gene id: | 55851 |
| Gene name: | PSENEN |
| Gene alias: | MDS033|MSTP064|PEN-2|PEN2 |
| Gene description: | presenilin enhancer 2 homolog (C. elegans) |
| Genbank accession: | BC009575 |
| Immunogen: | PSENEN (AAH09575, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP |
| Protein accession: | AAH09575 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |