Brand: | Abnova |
Reference: | H00055839-M01 |
Product name: | BM039 monoclonal antibody (M01), clone 4A5-1C11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant BM039. |
Clone: | 4A5-1C11 |
Isotype: | IgG1 kappa |
Gene id: | 55839 |
Gene name: | CENPN |
Gene alias: | BM039|C16orf60|CENP-N|FLJ13607|FLJ22660 |
Gene description: | centromere protein N |
Genbank accession: | BC007334 |
Immunogen: | BM039 (AAH07334, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN |
Protein accession: | AAH07334 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (48.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |