CAND1 polyclonal antibody (A01) View larger

CAND1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAND1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CAND1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055832-A01
Product name: CAND1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CAND1.
Gene id: 55832
Gene name: CAND1
Gene alias: DKFZp434M1414|FLJ10114|FLJ10929|FLJ38691|FLJ90441|KIAA0829|TIP120|TIP120A
Gene description: cullin-associated and neddylation-dissociated 1
Genbank accession: NM_018448
Immunogen: CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Protein accession: NP_060918
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055832-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00055832-A01-1-6-1.jpg
Application image note: CAND1 polyclonal antibody (A01), Lot # 051005JC01 Western Blot analysis of CAND1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CAND1 polyclonal antibody (A01) now

Add to cart