Brand: | Abnova |
Reference: | H00055823-M01 |
Product name: | VPS11 monoclonal antibody (M01), clone 1H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VPS11. |
Clone: | 1H1 |
Isotype: | IgG2b Kappa |
Gene id: | 55823 |
Gene name: | VPS11 |
Gene alias: | END1|PEP5|RNF108|hVPS11 |
Gene description: | vacuolar protein sorting 11 homolog (S. cerevisiae) |
Genbank accession: | NM_021729 |
Immunogen: | VPS11 (NP_068375, 842 a.a. ~ 941 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT |
Protein accession: | NP_068375 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | VPS11 monoclonal antibody (M01), clone 1H1 Western Blot analysis of VPS11 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |