Brand: | Abnova |
Reference: | H00055815-M02 |
Product name: | TSNAXIP1 monoclonal antibody (M02), clone 1D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSNAXIP1. |
Clone: | 1D6 |
Isotype: | IgG2a Kappa |
Gene id: | 55815 |
Gene name: | TSNAXIP1 |
Gene alias: | MGC111443|TXI1 |
Gene description: | translin-associated factor X interacting protein 1 |
Genbank accession: | NM_018430 |
Immunogen: | TSNAXIP1 (NP_060900, 269 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDEKDEYLQQLKQELGIELHEEVTLPKLRGGLMTIDPSLDKQTVNTYMSQAFQLPESEMPEEGDEKEEAVVEILQTALERLQVIDIRRVGPREPEP |
Protein accession: | NP_060900 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TSNAXIP1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |