Cart 5 Product Products 1 526,44 € (empty)
-
-
1 x Mouse...290,00 € -
-
-
No products
To be determined Shipping
1 526,44 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 526,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 526,44 €
Data sheet of FOXJ2 monoclonal antibody (M09A), clone 1G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about FOXJ2 monoclonal antibody (M09A), clone 1G12
| Brand: | Abnova |
| Reference: | H00055810-M09A |
| Product name: | FOXJ2 monoclonal antibody (M09A), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXJ2. |
| Clone: | 1G12 |
| Isotype: | IgM Kappa |
| Gene id: | 55810 |
| Gene name: | FOXJ2 |
| Gene alias: | FHX |
| Gene description: | forkhead box J2 |
| Genbank accession: | NM_018416 |
| Immunogen: | FOXJ2 (NP_060886.1, 475 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TQTGHVPPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLIT |
| Protein accession: | NP_060886.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |