Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DCP1A monoclonal antibody (M06), clone 3G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about DCP1A monoclonal antibody (M06), clone 3G4
| Brand: | Abnova |
| Reference: | H00055802-M06 |
| Product name: | DCP1A monoclonal antibody (M06), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCP1A. |
| Clone: | 3G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55802 |
| Gene name: | DCP1A |
| Gene alias: | FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF |
| Gene description: | DCP1 decapping enzyme homolog A (S. cerevisiae) |
| Genbank accession: | NM_018403 |
| Immunogen: | DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ |
| Protein accession: | NP_060873 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to DCP1A on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Pdc1 Functions in the Assembly of P Bodies in Schizosaccharomyces pombe.Wang CY, Chen WL, Wang SW Mol Cell Biol. 2013 Mar;33(6):1244-53. doi: 10.1128/MCB.01583-12. Epub 2013 Jan 14. |