DCP1A MaxPab rabbit polyclonal antibody (D01) View larger

DCP1A MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCP1A MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIP

More info about DCP1A MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00055802-D01
Product name: DCP1A MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human DCP1A protein.
Gene id: 55802
Gene name: DCP1A
Gene alias: FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF
Gene description: DCP1 decapping enzyme homolog A (S. cerevisiae)
Genbank accession: BC007439.2
Immunogen: DCP1A (AAH07439.1, 1 a.a. ~ 582 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Protein accession: AAH07439.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00055802-D01-31-15-1.jpg
Application image note: Immunoprecipitation of DCP1A transfected lysate using anti-DCP1A MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DCP1A purified MaxPab mouse polyclonal antibody (B01P) (H00055802-B01P).
Applications: IP
Shipping condition: Dry Ice

Reviews

Buy DCP1A MaxPab rabbit polyclonal antibody (D01) now

Add to cart