Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFT122 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IFT122 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00055764-A01 |
| Product name: | IFT122 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IFT122. |
| Gene id: | 55764 |
| Gene name: | IFT122 |
| Gene alias: | SPG|WDR10|WDR10p|WDR140 |
| Gene description: | intraflagellar transport 122 homolog (Chlamydomonas) |
| Genbank accession: | NM_052985 |
| Immunogen: | IFT122 (NP_443711, 1194 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPG |
| Protein accession: | NP_443711 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Essential role of nephrocystin in photoreceptor intraflagellar transport in mouse.Jiang ST, Chiou YY, Wang E, Chien YL, Ho HH, Tsai FJ, Lin CY, Tsai SP, Li H. Hum Mol Genet. 2009 May 1;18(9):1566-77. Epub 2009 Feb 9. |