UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00055757-D01P
Product name: UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human UGCGL2 protein.
Gene id: 55757
Gene name: UGCGL2
Gene alias: FLJ10873|FLJ11485|HUGT2|MGC117360|MGC150689|MGC87276
Gene description: UDP-glucose ceramide glucosyltransferase-like 2
Genbank accession: BC032302.1
Immunogen: UGCGL2 (AAH32302.1, 1 a.a. ~ 278 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS
Protein accession: AAH32302.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00055757-D01P-13-15-1.jpg
Application image note: Western Blot analysis of UGCGL2 expression in transfected 293T cell line (H00055757-T01) by UGCGL2 MaxPab polyclonal antibody.

Lane 1: UGCGL2 transfected lysate(31.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart