SEPT11 monoclonal antibody (M02), clone 1E5 View larger

SEPT11 monoclonal antibody (M02), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEPT11 monoclonal antibody (M02), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SEPT11 monoclonal antibody (M02), clone 1E5

Brand: Abnova
Reference: H00055752-M02
Product name: SEPT11 monoclonal antibody (M02), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant SEPT11.
Clone: 1E5
Isotype: IgG2b Lambda
Gene id: 55752
Gene name: SEPT11
Gene alias: -
Gene description: septin 11
Genbank accession: BC008083
Immunogen: SEPT11 (AAH08083, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYID
Protein accession: AAH08083
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055752-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055752-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SEPT11 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SEPT11 monoclonal antibody (M02), clone 1E5 now

Add to cart