CNDP2 polyclonal antibody (A01) View larger

CNDP2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNDP2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CNDP2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055748-A01
Product name: CNDP2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CNDP2.
Gene id: 55748
Gene name: CNDP2
Gene alias: CN2|CPGL|FLJ10830|HsT2298|PEPA
Gene description: CNDP dipeptidase 2 (metallopeptidase M20 family)
Genbank accession: NM_018235
Immunogen: CNDP2 (NP_060705, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH
Protein accession: NP_060705
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055748-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055748-A01-1-2-1.jpg
Application image note: CNDP2 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of CNDP2 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CNDP2 polyclonal antibody (A01) now

Add to cart