NUP133 monoclonal antibody (M01), clone 3E8 View larger

NUP133 monoclonal antibody (M01), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUP133 monoclonal antibody (M01), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about NUP133 monoclonal antibody (M01), clone 3E8

Brand: Abnova
Reference: H00055746-M01
Product name: NUP133 monoclonal antibody (M01), clone 3E8
Product description: Mouse monoclonal antibody raised against a partial recombinant NUP133.
Clone: 3E8
Isotype: IgG2a Kappa
Gene id: 55746
Gene name: NUP133
Gene alias: FLJ10814|MGC21133|hNUP133
Gene description: nucleoporin 133kDa
Genbank accession: NM_018230
Immunogen: NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
Protein accession: NP_060700
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055746-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.31 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055746-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged NUP133 is 0.03 ng/ml as a capture antibody.
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Alterations in Nuclear Pore Architecture Allow Cancer Cell Entry into or Exit from Drug-Resistant Dormancy.Kinoshita Y, Kalir T, Rahaman J, Dottino P, Stave Kohtz D.
Am J Pathol. 2011 Nov 7.

Reviews

Buy NUP133 monoclonal antibody (M01), clone 3E8 now

Add to cart