> >>C7orf44 purified MaxPab mouse polyclonal antibody (B02P)
C7orf44 purified MaxPab mouse polyclonal antibody (B02P) View larger

C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about C7orf44 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00055744-B02P
Product name: C7orf44 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human C7orf44 protein.
Gene id: 55744
Gene name: C7orf44
Gene alias: FLJ10803
Gene description: chromosome 7 open reading frame 44
Genbank accession: BC056884
Immunogen: C7orf44 (AAH56884, 1 a.a. ~ 146 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSKGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
Protein accession: AAH56884
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055744-B02P-13-15-1.jpg
Application image note: Western Blot analysis of C7orf44 expression in transfected 293T cell line (H00055744-T03) by C7orf44 MaxPab polyclonal antibody.

Lane 1: C7orf44 transfected lysate(16.17 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C7orf44 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart