Brand: | Abnova |
Reference: | H00055723-M03 |
Product name: | ASF1B monoclonal antibody (M03), clone 1B12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ASF1B. |
Clone: | 1B12 |
Isotype: | IgG2a Kappa |
Gene id: | 55723 |
Gene name: | ASF1B |
Gene alias: | CIA-II|FLJ10604 |
Gene description: | ASF1 anti-silencing function 1 homolog B (S. cerevisiae) |
Genbank accession: | BC036521 |
Immunogen: | ASF1B (AAH36521, 1 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFGQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI |
Protein accession: | AAH36521 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ASF1B is 3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |