Brand: | Abnova |
Reference: | H00055692-M05 |
Product name: | LUC7L monoclonal antibody (M05), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LUC7L. |
Clone: | 2D10 |
Isotype: | IgG1 Kappa |
Gene id: | 55692 |
Gene name: | LUC7L |
Gene alias: | FLJ10231|LUC7-LIKE|LUC7B1|SR+89 |
Gene description: | LUC7-like (S. cerevisiae) |
Genbank accession: | NM_018032 |
Immunogen: | LUC7L (NP_060502, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE |
Protein accession: | NP_060502 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |