DSU monoclonal antibody (M01), clone 8F9-1B2 View larger

DSU monoclonal antibody (M01), clone 8F9-1B2

H00055686-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DSU monoclonal antibody (M01), clone 8F9-1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about DSU monoclonal antibody (M01), clone 8F9-1B2

Brand: Abnova
Reference: H00055686-M01
Product name: DSU monoclonal antibody (M01), clone 8F9-1B2
Product description: Mouse monoclonal antibody raised against a full length recombinant DSU.
Clone: 8F9-1B2
Isotype: IgG1 kappa
Gene id: 55686
Gene name: MREG
Gene alias: DSU|FLJ10116|MGC90296|WDT2
Gene description: melanoregulin
Genbank accession: BC032747
Immunogen: DSU (AAH32747, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
Protein accession: AAH32747
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055686-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.28 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055686-M01-13-15-1.jpg
Application image note: Western Blot analysis of DSU expression in transfected 293T cell line by DSU monoclonal antibody (M01), clone 8F9-1B2.

Lane 1: DSU transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy DSU monoclonal antibody (M01), clone 8F9-1B2 now

Add to cart