MFN1 polyclonal antibody (A01) View larger

MFN1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFN1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MFN1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055669-A01
Product name: MFN1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MFN1.
Gene id: 55669
Gene name: MFN1
Gene alias: DKFZp762F247|FLJ20693|MGC41806|hfzo1|hfzo2
Gene description: mitofusin 1
Genbank accession: NM_017927
Immunogen: MFN1 (NP_060397, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV
Protein accession: NP_060397
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055669-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055669-A01-1-6-1.jpg
Application image note: MFN1 polyclonal antibody (A01), Lot # NBI0061117QCS1 Western Blot analysis of MFN1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MFN1 polyclonal antibody (A01) now

Add to cart