HIF1AN MaxPab mouse polyclonal antibody (B01) View larger

HIF1AN MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIF1AN MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HIF1AN MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00055662-B01
Product name: HIF1AN MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HIF1AN protein.
Gene id: 55662
Gene name: HIF1AN
Gene alias: DKFZp762F1811|FIH1|FLJ20615|FLJ22027
Gene description: hypoxia inducible factor 1, alpha subunit inhibitor
Genbank accession: BC007719.2
Immunogen: HIF1AN (AAH07719.1, 1 a.a. ~ 349 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Protein accession: AAH07719.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055662-B01-13-15-1.jpg
Application image note: Western Blot analysis of HIF1AN expression in transfected 293T cell line (H00055662-T01) by HIF1AN MaxPab polyclonal antibody.

Lane 1: HIF1AN transfected lysate(38.39 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HIF1AN MaxPab mouse polyclonal antibody (B01) now

Add to cart