HIF1AN polyclonal antibody (A01) View larger

HIF1AN polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIF1AN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HIF1AN polyclonal antibody (A01)

Brand: Abnova
Reference: H00055662-A01
Product name: HIF1AN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant HIF1AN.
Gene id: 55662
Gene name: HIF1AN
Gene alias: DKFZp762F1811|FIH1|FLJ20615|FLJ22027
Gene description: hypoxia inducible factor 1, alpha subunit inhibitor
Genbank accession: BC007719
Immunogen: HIF1AN (AAH07719.1, 1 a.a. ~ 349 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Protein accession: AAH07719.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055662-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (64.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIF1AN polyclonal antibody (A01) now

Add to cart