Cart 2 Product Products 193,34 € (empty)
No products
To be determined Shipping
193,34 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 193,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 193,34 €
Data sheet of RAB20 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about RAB20 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00055647-B01P |
| Product name: | RAB20 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human RAB20 protein. |
| Gene id: | 55647 |
| Gene name: | RAB20 |
| Gene alias: | FLJ20429 |
| Gene description: | RAB20, member RAS oncogene family |
| Genbank accession: | NM_017817 |
| Immunogen: | RAB20 (NP_060287.1, 1 a.a. ~ 234 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA |
| Protein accession: | NP_060287.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RAB20 expression in transfected 293T cell line (H00055647-T01) by RAB20 MaxPab polyclonal antibody. Lane 1: RAB20 transfected lysate(25.74 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The GTPase Rab20 is a HIF target with mitochondrial localization mediating apoptosis in hypoxia.Hackenbeck T, Huber R, Schietke R, Knaup KX, Monti J, Wu X, Klanke B, Frey B, Gaipl U, Wullich B, Ferbus D, Goubin G, Warnecke C, Eckardt KU, Wiesener MS. Biochim Biophys Acta. 2010 Nov 4. [Epub ahead of print] |